PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10039704
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 220aa    MW: 25459.1 Da    PI: 9.0852
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10039704genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF45.59.9e-151155751
                 HHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  7 snrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  ++  +++k r g+ KKA+ELS  C+++v +i+fs++gkl ++++
  Lus10039704 11 KKKVGSYCKQRDGMVKKANELSEQCGVDVGLIMFSPKGKLTTFAT 55
                 555669*************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.3E-11156IPR002100Transcription factor, MADS-box
PROSITE profilePS5006614.815157IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.71E-16571IPR002100Transcription factor, MADS-box
PfamPF003193.1E-141053IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-71934IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-73455IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MARRKFLMKK KKKVGSYCKQ RDGMVKKANE LSEQCGVDVG LIMFSPKGKL TTFATKGRIE  60
DVFLRYIERS DEIENHENLY RSLKQLRHEG EMLEKLDRIE ALEEELQELN KQQSQKEEQL  120
KCYNLDVQKI RSISEALLHQ QFLTTAIQNI QRLKLQQNLI SQMKLRNPET LEVADLTPKE  180
SIEKQRNQAG DYGGSSTGGP HLSLEFLTKQ QHWNLGTDH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1753967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77980.11e-16AGAMOUS-like 66